TB500 – 5mg

Original price was: £ 21.90.Current price is: £ 19.90.

TB500 – 5mg

Original price was: £ 21.90.Current price is: £ 19.90.

Buy 2 Image

BUY 2, SAVE 2.5%

£19.90 £19.40 / ITEM

Buy 3 Image

BUY 3, SAVE 5%

£19.90 £18.91 / ITEM

Highest Value
Buy 5 Image

BUY 5, SAVE 10%

£19.90 £17.91 / ITEM

39 in stock

Customers Reviews

TB500 5mg – Premium Research Peptide

TB500, available in a 5mg concentration, is a high-purity research peptide designed for advanced scientific exploration. Known for its potential in cellular regeneration and tissue repair studies, TB-500 is ideal for laboratory environments where precision and reliability are critical to achieving meaningful results.

Product Details:

  • Name: TB-500 5mg
  • Catalogue Number: TB5
  • Chemical Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity Level: ≥98%
  • Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Physical Form: Lyophilized Powder

Applications and Research Potential:

TB500 is widely studied for its ability to promote cellular regeneration, wound healing, and tissue repair. It has garnered attention for its role in research investigating inflammation modulation, angiogenesis, and improved recovery times. This peptide’s unique properties make it an excellent choice for advanced studies in regenerative medicine. For additional insights into regenerative medicine, visit the UK Research and Innovation (UKRI).

Usage and Storage:

TB500 is supplied as a lyophilized powder to ensure maximum stability and ease of handling. Proper reconstitution and storage are vital to maintaining the product’s integrity. Researchers are encouraged to store the peptide at -20°C, away from light and moisture, and refer to detailed guidelines on our website. For laboratory handling protocols, consult the Health and Safety Executive (HSE).

Synthesis and Quality Assurance:

TB-500 is synthesized using a meticulously controlled process to achieve an exceptional purity level of ≥98%. Every batch undergoes stringent quality control testing to ensure consistency and reliability in experimental applications. This commitment to quality makes TB-500 a trusted choice for researchers. Learn more about peptide synthesis standards at the British Pharmacopoeia (BP).

Regulatory and Safety Notes:

Kensington Labs offers TB500 strictly for scientific and research purposes, adhering to all relevant quality and legal standards. This peptide is not intended for human consumption, diagnostic use, or therapeutic applications. Researchers must handle it with care and follow all recommended safety protocols. For UK regulatory guidance, refer to the Medicines and Healthcare Products Regulatory Agency (MHRA).

Why Choose Kensington Labs?

At Kensington Labs, we are dedicated to providing high-quality research peptides that meet the demands of advanced scientific studies. TB-500 is a reliable and trusted solution for researchers exploring cellular regeneration, tissue repair, and related fields. Our commitment to excellence ensures consistent and reproducible results for groundbreaking research. For insights into cutting-edge scientific advancements, explore resources at the Royal Society.

Dont forget you BACTERIOSTATIC WATER for mixing!

Used solely for in vitro experiments and cannot be:
* Used in clinical trials involving humans.
* Administered to humans as part of an experiment or investigation.
* Supplied to another party for human investigational use.

Bundles

Check out the bundles to help you get started

Premium Pure Powerful Peptides

Your Reliable Source for High-Quality Research Peptides

Kensington Labs™ is more than just a trusted U.K. supplier of research peptides. We are
a catalyst for scientific advancement, dedicated to providing the highest quality peptides
that empower our clients to push the boundaries.

Unparalleled Quality

Our proprietary processes and meticulous sourcing of premium materials ensure that every peptide we offer meets the most stringent standards.

Independently Verified

Every product undergoes extensive testing, both in-house and through independent, third-party laboratories.

Fast Shipping & Support

We provide fast and reliable shipping, using the best couriers and high-quality packaging materials to ensure that your peptides arrive.

Customers Reviews

Emily Jeff CEO
TheWebagency

Ten the hastened steepest feelings pleasant few surprise property. An brother he do colonel against.

Hamza Malik Manager TheWekrtech

Can how elinor warmly mrs basket marked. Led raising expense yet demesne weather musical. Me mr what.

Elizabeth Rai Developer I2c Company

park next busy ever. Elinor her his secure far twenty eat object. Any far saw size want man. Which way you wrong.

Sara Thomas Accountant TheConsturction

Concerns greatest margaret him absolute entrance nay. Door neat week do find past he. Be no surprise he honoured.

Hamza Malik Manager TheWekrtech

Can how elinor warmly mrs basket marked. Led raising expense yet demesne weather musical. Me mr what.

Emily Jeff CEO
TheWebagency

Ten the hastened steepest feelings pleasant few surprise property. An brother he do colonel against.

Customers Reviews

1
    1
    Your Cart
    BPC 157 - 10mg
    BPC 157 - 10mg
    1 X £ 30.90 = £ 30.90