TB500 10mg – Premium Research Peptide
TB500, available in a 10mg concentration, is a high-purity research peptide designed for advanced scientific exploration. Known for its potential in cellular regeneration and tissue repair studies, TB-500 is ideal for laboratory environments where precision and reliability are critical to achieving meaningful results.
Product Details:
- Name: TB-500 10mg
- Catalogue Number: TB10
- Chemical Formula: C212H350N56O78S
- Molecular Weight: 4963.4 g/mol
- Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Physical Form: Lyophilized Powder
Applications and Research Potential:
TB500 is widely studied for its ability to promote cellular regeneration, wound healing, and tissue repair. It has garnered attention for its role in research investigating inflammation modulation, angiogenesis, and improved recovery times. This peptide’s unique properties make it an excellent choice for advanced studies in regenerative medicine. For additional insights into regenerative medicine, visit the UK Research and Innovation (UKRI).
Usage and Storage:
TB500 is supplied as a lyophilized powder to ensure maximum stability and ease of handling. Proper reconstitution and storage are vital to maintaining the product’s integrity. Researchers are encouraged to store the peptide at -20°C, away from light and moisture, and refer to detailed guidelines on our website. For laboratory handling protocols, consult the Health and Safety Executive (HSE).
Synthesis and Quality Assurance:
TB-500 is synthesized using a meticulously controlled process to achieve an exceptional purity level of ≥98%. Every batch undergoes stringent quality control testing to ensure consistency and reliability in experimental applications. This commitment to quality makes TB-500 a trusted choice for researchers. Learn more about peptide synthesis standards at the British Pharmacopoeia (BP).
Regulatory and Safety Notes:
Kensington Labs offers TB500 strictly for scientific and research purposes, adhering to all relevant quality and legal standards. This peptide is not intended for human consumption, diagnostic use, or therapeutic applications. Researchers must handle it with care and follow all recommended safety protocols. For UK regulatory guidance, refer to the Medicines and Healthcare Products Regulatory Agency (MHRA).
Why Choose Kensington Labs?
At Kensington Labs, we are dedicated to providing high-quality research peptides that meet the demands of advanced scientific studies. TB-500 is a reliable and trusted solution for researchers exploring cellular regeneration, tissue repair, and related fields. Our commitment to excellence ensures consistent and reproducible results for groundbreaking research. For insights into cutting-edge scientific advancements, explore resources at the Royal Society.
Dont forget you BACTERIOSTATIC WATER for mixing!
